| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50147197 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158997 (CHEMBL763924) |
|---|
| IC50 | 3000±n/a nM |
|---|
| Citation |  Yehia, NA; Antuch, W; Beck, B; Hess, S; Schauer-Vukasinovic, V; Almstetter, M; Furer, P; Herdtweck, E; Dömling, A Novel nonpeptidic inhibitors of HIV-1 protease obtained via a new multicomponent chemistry strategy. Bioorg Med Chem Lett14:3121-5 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50147197 |
|---|
| n/a |
|---|
| Name | BDBM50147197 |
|---|
| Synonyms: | 3-Hydroxy-5-oxo-2,4-diphenethyl-2,5-dihydro-furan-2-carboxylic acid tert-butylamide | CHEMBL104253 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H29NO4 |
|---|
| Mol. Mass. | 407.5021 |
|---|
| SMILES | CC(C)(C)NC(=O)C1(CCc2ccccc2)OC(=O)C(CCc2ccccc2)C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
