| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Ligand | BDBM50149319 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_205065 (CHEMBL810259) |
|---|
| IC50 | 149±n/a nM |
|---|
| Citation |  Occhiato, EG; Ferrali, A; Menchi, G; Guarna, A; Danza, G; Comerci, A; Mancina, R; Serio, M; Garotta, G; Cavalli, A; De Vivo, M; Recanatini, M Synthesis, biological activity, and three-dimensional quantitative structure-activity relationship model for a series of benzo[c]quinolizin-3-ones, nonsteroidal inhibitors of human steroid 5alpha-reductase 1. J Med Chem47:3546-60 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29472.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P18405 |
|---|
| Residue: | 259 |
|---|
| Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
|---|
| BDBM50149319 |
|---|
| n/a |
|---|
| Name | BDBM50149319 |
|---|
| Synonyms: | 8-(2,4-Bis-trifluoromethyl-benzyloxy)-4-methyl-1,2,5,6-tetrahydro-pyrido[1,2-a]quinolin-3-one | CHEMBL118452 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H19F6NO2 |
|---|
| Mol. Mass. | 455.3929 |
|---|
| SMILES | CC1=C2CCc3cc(OCc4ccc(cc4C(F)(F)F)C(F)(F)F)ccc3N2CCC1=O |c:1| |
|---|
| Structure | 
|
|---|
Search and Browse
