Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Ligand | BDBM50025356 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_205065 (CHEMBL810259) |
---|
IC50 | 911±n/a nM |
---|
Citation | Occhiato, EG; Ferrali, A; Menchi, G; Guarna, A; Danza, G; Comerci, A; Mancina, R; Serio, M; Garotta, G; Cavalli, A; De Vivo, M; Recanatini, M Synthesis, biological activity, and three-dimensional quantitative structure-activity relationship model for a series of benzo[c]quinolizin-3-ones, nonsteroidal inhibitors of human steroid 5alpha-reductase 1. J Med Chem47:3546-60 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
Type: | Enzyme |
Mol. Mass.: | 29472.80 |
Organism: | Homo sapiens (Human) |
Description: | P18405 |
Residue: | 259 |
Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
BDBM50025356 |
---|
n/a |
---|
Name | BDBM50025356 |
Synonyms: | 4a,6a-Dimethyl-2-oxo-2,4a,4b,5,6,6a,7,8,9,9a,9b,10,11,11a-tetradecahydro-1H-indeno[5,4-f]quinoline-7-carboxylic acid tert-butylamide | CHEMBL710 | Finasteride | N-tert-butyl-2,15-dimethyl-5-oxo-6-azatetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadec-3-ene-14-carboxamide |
Type | Small organic molecule |
Emp. Form. | C23H36N2O2 |
Mol. Mass. | 372.5441 |
SMILES | CC(C)(C)NC(=O)C1CCC2C3CCC4NC(=O)C=CC4(C)C3CCC12C |c:18| |
Structure |
|