| Reaction Details |
|---|
 | Report a problem with these data |
| Target | von Hippel-Lindau disease tumor suppressor |
|---|
| Ligand | BDBM50581594 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2151709 (CHEMBL5036171) |
|---|
| Kd | 200±n/a nM |
|---|
| Citation |  Klein, VG; Bond, AG; Craigon, C; Lokey, RS; Ciulli, A Amide-to-Ester Substitution as a Strategy for Optimizing PROTAC Permeability and Cellular Activity. J Med Chem64:18082-18101 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| von Hippel-Lindau disease tumor suppressor |
|---|
| Name: | von Hippel-Lindau disease tumor suppressor |
|---|
| Synonyms: | Protein G7 | VHL | VHL_HUMAN | Von Hippel-Lindau disease tumor suppressor | Von Hippel-Lindau disease tumor suppressor protein (VBC) | pVHL |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24136.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P40337 |
|---|
| Residue: | 213 |
|---|
| Sequence: | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR
DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDI
VRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
|
|
|
|---|
| BDBM50581594 |
|---|
| n/a |
|---|
| Name | BDBM50581594 |
|---|
| Synonyms: | CHEMBL5086897 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H48N4O8S |
|---|
| Mol. Mass. | 708.864 |
|---|
| SMILES | Cc1ncsc1-c1ccc(CNC(=O)[C@@H]2C[C@@H](O)CN2C(=O)[C@@H](NC(=O)CCOCCOCCOC(=O)Cc2ccccc2)C(C)(C)C)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
