| Reaction Details |
|---|
 | Report a problem with these data |
| Target | von Hippel-Lindau disease tumor suppressor |
|---|
| Ligand | BDBM50581599 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2151717 (CHEMBL5036179) |
|---|
| Kd | 63±n/a nM |
|---|
| Citation |  Klein, VG; Bond, AG; Craigon, C; Lokey, RS; Ciulli, A Amide-to-Ester Substitution as a Strategy for Optimizing PROTAC Permeability and Cellular Activity. J Med Chem64:18082-18101 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| von Hippel-Lindau disease tumor suppressor |
|---|
| Name: | von Hippel-Lindau disease tumor suppressor |
|---|
| Synonyms: | Protein G7 | VHL | VHL_HUMAN | Von Hippel-Lindau disease tumor suppressor | Von Hippel-Lindau disease tumor suppressor protein (VBC) | pVHL |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24136.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P40337 |
|---|
| Residue: | 213 |
|---|
| Sequence: | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR
DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDI
VRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
|
|
|
|---|
| BDBM50581599 |
|---|
| n/a |
|---|
| Name | BDBM50581599 |
|---|
| Synonyms: | CHEMBL5087181 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C49H59ClN8O8S2 |
|---|
| Mol. Mass. | 987.625 |
|---|
| SMILES | C[C@H](NC(=O)[C@@H]1C[C@@H](O)CN1C(=O)[C@@H](NC(=O)COCCCOCCOC(=O)C[C@@H]1N=C(c2c(C)c(C)sc2-n2c(C)nnc12)c1ccc(Cl)cc1)C(C)(C)C)c1ccc(cc1)-c1scnc1C |r,c:31| |
|---|
| Structure | 
|
|---|
Search and Browse
