| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Lysophosphatidic acid receptor 3 |
|---|
| Ligand | BDBM50146230 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_304755 (CHEMBL829353) |
|---|
| Ki | 940±n/a nM |
|---|
| Citation |  Heasley, BH; Jarosz, R; Carter, KM; Van, SJ; Lynch, KR; Macdonald, TL A novel series of 2-pyridyl-containing compounds as lysophosphatidic acid receptor antagonists: development of a nonhydrolyzable LPA3 receptor-selective antagonist. Bioorg Med Chem Lett14:4069-74 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Lysophosphatidic acid receptor 3 |
|---|
| Name: | Lysophosphatidic acid receptor 3 |
|---|
| Synonyms: | EDG7 | LPA3 | LPAR3 | LPAR3_HUMAN | Lysophosphatidic acid receptor 1/3 | Lysophosphatidic acid receptor 3 (LPAR3) | Lysophosphatidic acid receptor Edg-7 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40149.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9UBY5 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
|
|
|
|---|
| BDBM50146230 |
|---|
| n/a |
|---|
| Name | BDBM50146230 |
|---|
| Synonyms: | CHEMBL314555 | Phosphoric acid mono-{(S)-2-((Z)-octadec-9-enoylamino)-3-[4-(pyridin-2-ylmethoxy)-phenyl]-propyl} ester | Phosphoric acid mono-{2-((Z)-(S)-octadec-9-enoylamino)-3-[4-(pyridin-2-ylmethoxy)-phenyl]-propyl} ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H51N2O6P |
|---|
| Mol. Mass. | 602.7416 |
|---|
| SMILES | CCCCCCCC\C=C/CCCCCCCC(=O)N[C@H](COP(O)(O)=O)Cc1ccc(OCc2ccccn2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
