Reaction Details |
| Report a problem with these data |
Target | Nociceptin receptor |
---|
Ligand | BDBM50022784 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_305510 |
---|
IC50 | >5000±n/a nM |
---|
Citation | Creighton, CJ; Ramabadran, K; Ciccone, PE; Liu, J; Orsini, MJ; Reitz, AB Synthesis and biological evaluation of the major metabolite of atomoxetine: elucidation of a partial kappa-opioid agonist effect. Bioorg Med Chem Lett14:4083-5 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nociceptin receptor |
---|
Name: | Nociceptin receptor |
Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40702.87 |
Organism: | Homo sapiens (Human) |
Description: | P41146 |
Residue: | 370 |
Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
BDBM50022784 |
---|
n/a |
---|
Name | BDBM50022784 |
Synonyms: | (R)-N-methyl-3-phenyl-3-(o-tolyloxy)propan-1-amine | ATOMOXETINE | CHEMBL641 | Methyl-((R)-3-phenyl-3-o-tolyloxy-propyl)-amine | Methyl-(3-phenyl-3-o-tolyloxy-propyl)-amine | Methyl-(3-phenyl-3-o-tolyloxy-propyl)-amine(tomoxetine) | Strattera | Tomoxetine |
Type | Small organic molecule |
Emp. Form. | C17H21NO |
Mol. Mass. | 255.3547 |
SMILES | CNCCC(Oc1ccccc1C)c1ccccc1 |
Structure |
|