| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phenylethanolamine N-methyltransferase |
|---|
| Ligand | BDBM50151343 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303718 (CHEMBL829053) |
|---|
| Ki | 1200±n/a nM |
|---|
| Citation |  Romero, FA; Vodonick, SM; Criscione, KR; McLeish, MJ; Grunewald, GL Inhibitors of phenylethanolamine N-methyltransferase that are predicted to penetrate the blood-brain barrier: design, synthesis, and evaluation of 3-fluoromethyl-7-(N-substituted aminosulfonyl)-1,2,3,4-tetrahydroisoquinolines that possess low affinity toward the alpha2-adrenoceptor. J Med Chem47:4483-93 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phenylethanolamine N-methyltransferase |
|---|
| Name: | Phenylethanolamine N-methyltransferase |
|---|
| Synonyms: | Noradrenaline N-methyltransferase | PENT | PNMT | PNMT_HUMAN | PNMTase | Phenylethanolamine N-Methyltransferase (PNMT) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 30852.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 282 |
|---|
| Sequence: | MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGA
FNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVR
EALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
|
|
|
|---|
| BDBM50151343 |
|---|
| n/a |
|---|
| Name | BDBM50151343 |
|---|
| Synonyms: | (+)-3-(fluoromethyl)-7-(thiomorpholinosulfonyl)-1,2,3,4-tetrahydroisoquinoline | 3-Fluoromethyl-7-(thiomorpholine-4-sulfonyl)-1,2,3,4-tetrahydro-isoquinoline | CHEMBL355581 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H19FN2O2S2 |
|---|
| Mol. Mass. | 330.441 |
|---|
| SMILES | FCC1Cc2ccc(cc2CN1)S(=O)(=O)N1CCSCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
