Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, heart |
---|
Ligand | BDBM50152879 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_306241 (CHEMBL830338) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Ringom, R; Axen, E; Uppenberg, J; Lundbäck, T; Rondahl, L; Barf, T Substituted benzylamino-6-(trifluoromethyl)pyrimidin-4(1H)-ones: a novel class of selective human A-FABP inhibitors. Bioorg Med Chem Lett14:4449-52 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, heart |
---|
Name: | Fatty acid-binding protein, heart |
Synonyms: | FABP11 | FABP3 | FABPH_HUMAN | Fatty acid binding protein muscle | MDGI |
Type: | PROTEIN |
Mol. Mass.: | 14858.36 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1463784 |
Residue: | 133 |
Sequence: | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
|
|
|
BDBM50152879 |
---|
n/a |
---|
Name | BDBM50152879 |
Synonyms: | 2-(4-Methoxy-benzylamino)-6-trifluoromethyl-pyrimidin-4-ol | CHEMBL182801 |
Type | Small organic molecule |
Emp. Form. | C13H12F3N3O2 |
Mol. Mass. | 299.2485 |
SMILES | COc1ccc(CNc2nc(cc(=O)[nH]2)C(F)(F)F)cc1 |
Structure |
|