| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanin-concentrating hormone receptor 1 |
|---|
| Ligand | BDBM50152456 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_430510 (CHEMBL917759) |
|---|
| Ki | 2±n/a nM |
|---|
| Citation |  Lavrador, K; Murphy, B; Saunders, J; Struthers, S; Wang, X; Williams, J A screening library for peptide activated G-protein coupled receptors. 1. The test set. J Med Chem47:6864-74 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanin-concentrating hormone receptor 1 |
|---|
| Name: | Melanin-concentrating hormone receptor 1 |
|---|
| Synonyms: | G-protein coupled receptor 24 | Gpr24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCH1R | MCHR | MCHR-1 | MCHR1_RAT | Mchr1 | Melanin Concentrating Hormone 1 | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1 | SLC-1 | Slc1 | Somatostatin receptor-like protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39075.64 |
|---|
| Organism: | RAT |
|---|
| Description: | Melanin Concentrating Hormone 1 GPR24 RAT::P97639 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLLGIVGNST
VIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
AMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWL
YARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVA
PASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLG
YANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
|
|
|
|---|
| BDBM50152456 |
|---|
| n/a |
|---|
| Name | BDBM50152456 |
|---|
| Synonyms: | (S)-3-{3-[4-(3-Acetylamino-phenyl)-piperidin-1-yl]-propylcarbamoyl}-4-(3,4-difluoro-phenyl)-6-methoxymethyl-2-oxo-1,2,3,4-tetrahydro-pyrimidine-5-carboxylic acid methyl ester | (S)-methyl 1-((3-(4-(3-acetamidophenyl)piperidin-1-yl)propyl)carbamoyl)-6-(3,4-difluorophenyl)-4-(methoxymethyl)-2-oxo-1,2,3,6-tetrahydropyrimidine-5-carboxylate | CHEMBL185271 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H37F2N5O6 |
|---|
| Mol. Mass. | 613.6522 |
|---|
| SMILES | COCC1=C([C@@H](N(C(=O)NCCCN2CCC(CC2)c2cccc(NC(C)=O)c2)C(=O)N1)c1ccc(F)c(F)c1)C(=O)OC |t:3| |
|---|
| Structure | 
|
|---|
Search and Browse
