Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50159098 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_303755 (CHEMBL829798) |
---|
Ki | 1279.258±n/a nM |
---|
Citation | Trapani, G; Laquintana, V; Denora, N; Trapani, A; Lopedota, A; Latrofa, A; Franco, M; Serra, M; Pisu, MG; Floris, I; Sanna, E; Biggio, G; Liso, G Structure-activity relationships and effects on neuroactive steroid synthesis in a series of 2-phenylimidazo[1,2-a]pyridineacetamide peripheral benzodiazepine receptors ligands. J Med Chem48:292-305 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50159098 |
---|
n/a |
---|
Name | BDBM50159098 |
Synonyms: | 2-(6,8-Dichloro-2-phenyl-imidazo[1,2-a]pyridin-3-yl)-N-methyl-N-(2-pyridin-2-yl-ethyl)-acetamide | CHEMBL179427 |
Type | Small organic molecule |
Emp. Form. | C23H20Cl2N4O |
Mol. Mass. | 439.337 |
SMILES | CN(CCc1ccccn1)C(=O)Cc1c(nc2c(Cl)cc(Cl)cn12)-c1ccccc1 |
Structure |
|