Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50589705 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2194198 (CHEMBL5106558) |
---|
Ki | 19±n/a nM |
---|
Citation | Mishiro, K; Wang, M; Hirata, S; Fuchigami, T; Shiba, K; Kinuya, S; Ogawa, K Development of tumor-targeting aza-vesamicol derivatives with high affinity for sigma receptors for cancer theranostics. RSC Med Chem13:986-997 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50589705 |
---|
n/a |
---|
Name | BDBM50589705 |
Synonyms: | CHEMBL5191856 |
Type | Small organic molecule |
Emp. Form. | C19H29BrN2O |
Mol. Mass. | 381.35 |
SMILES | O[C@H]1CCCC[C@@H]1N1CCN(CCCc2ccccc2Br)CC1 |r| |
Structure |
|