| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50589707 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2194199 (CHEMBL5106559) |
|---|
| Ki | 22±n/a nM |
|---|
| Citation |  Mishiro, K; Wang, M; Hirata, S; Fuchigami, T; Shiba, K; Kinuya, S; Ogawa, K Development of tumor-targeting aza-vesamicol derivatives with high affinity for sigma receptors for cancer theranostics. RSC Med Chem13:986-997 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50589707 |
|---|
| n/a |
|---|
| Name | BDBM50589707 |
|---|
| Synonyms: | CHEMBL5171607 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H29BrN2O |
|---|
| Mol. Mass. | 381.35 |
|---|
| SMILES | O[C@H]1CCCC[C@@H]1N1CCN(CCCc2cccc(Br)c2)CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
