| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sortase family protein |
|---|
| Ligand | BDBM50590366 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2196389 (CHEMBL5108905) |
|---|
| Ki | 2453±n/a nM |
|---|
| Citation |  Guan, XN; Zhang, T; Yang, T; Dong, Z; Yang, S; Lan, L; Gan, J; Yang, CG Covalent sortase A inhibitor ML346 prevents RSC Med Chem13:138-149 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sortase family protein |
|---|
| Name: | Sortase family protein |
|---|
| Synonyms: | Sortase | Sortase A (SrtA) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23546.15 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQ
AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLT
LITCDDYNEKTGVWEKRKIFVATEVK
|
|
|
|---|
| BDBM50590366 |
|---|
| n/a |
|---|
| Name | BDBM50590366 |
|---|
| Synonyms: | CHEMBL5174805 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H12N2O4 |
|---|
| Mol. Mass. | 272.2561 |
|---|
| SMILES | [#6]-[#8]-c1ccc(\[#6]=[#6]\[#6]=[#6]-2/[#6](=O)-[#7]-[#6](=O)-[#7]-[#6]-2=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
