| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RNA-directed RNA polymerase |
|---|
| Ligand | BDBM50162519 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_306584 (CHEMBL832931) |
|---|
| IC50 | 300±n/a nM |
|---|
| Citation |  Burton, G; Ku, TW; Carr, TJ; Kiesow, T; Sarisky, RT; Lin-Goerke, J; Baker, A; Earnshaw, DL; Hofmann, GA; Keenan, RM; Dhanak, D Identification of small molecule inhibitors of the hepatitis C virus RNA-dependent RNA polymerase from a pyrrolidine combinatorial mixture. Bioorg Med Chem Lett15:1553-6 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RNA-directed RNA polymerase |
|---|
| Name: | RNA-directed RNA polymerase |
|---|
| Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25173.95 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | Q8JXU8 |
|---|
| Residue: | 229 |
|---|
| Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
|---|
| BDBM50162519 |
|---|
| n/a |
|---|
| Name | BDBM50162519 |
|---|
| Synonyms: | (2S,4S,5R)-2-ISOBUTYL-5-(2-THIENYL)-1-[4-(TRIFLUOROMETHYL)BENZOYL]PYRROLIDINE-2,4-DICARBOXYLIC ACID | (2S,4S,5R)-2-Isobutyl-5-thiophen-2-yl-1-(4-trifluoromethyl-benzoyl)-pyrrolidine-2,4-dicarboxylic acid | (2S,4S,5R)-2-isobutyl-5-(thiophen-2-yl)-1-(4-(trifluoromethyl)benzoyl)pyrrolidine-2,4-dicarboxylic acid | CHEMBL180948 | rac-(2S,4S,5R)-1-[1-(4-trifluoromethyl-phenyl)-methanoyl]-2-isobutyl-5-thiophen-2-yl-pyrrolidine-2,4-dicarboxylic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22F3NO5S |
|---|
| Mol. Mass. | 469.474 |
|---|
| SMILES | CC(C)C[C@]1(C[C@@H]([C@@H](N1C(=O)c1ccc(cc1)C(F)(F)F)c1cccs1)C(O)=O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
