| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RNA-directed RNA polymerase |
|---|
| Ligand | BDBM50167634 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_306492 (CHEMBL827995) |
|---|
| IC50 | 2600±n/a nM |
|---|
| Citation |  Pfefferkorn, JA; Nugent, R; Gross, RJ; Greene, M; Mitchell, MA; Reding, MT; Funk, LA; Anderson, R; Wells, PA; Shelly, JA; Anstadt, R; Finzel, BC; Harris, MS; Kilkuskie, RE; Kopta, LA; Schwende, FJ Inhibitors of HCV NS5B polymerase. Part 2: Evaluation of the northern region of (2Z)-2-benzoylamino-3-(4-phenoxy-phenyl)-acrylic acid. Bioorg Med Chem Lett15:2812-8 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RNA-directed RNA polymerase |
|---|
| Name: | RNA-directed RNA polymerase |
|---|
| Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25173.95 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | Q8JXU8 |
|---|
| Residue: | 229 |
|---|
| Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
|---|
| BDBM50167634 |
|---|
| n/a |
|---|
| Name | BDBM50167634 |
|---|
| Synonyms: | (Z)-3-[4-(2-Bromo-phenoxy)-phenyl]-2-(3-p-tolyl-propionylamino)-acrylic acid | CHEMBL194227 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H22BrNO4 |
|---|
| Mol. Mass. | 480.35 |
|---|
| SMILES | Cc1ccc(CCC(=O)N\C(=C/c2ccc(Oc3ccccc3Br)cc2)C(O)=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
