| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase, mitochondrial |
|---|
| Ligand | BDBM50594242 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2211492 (CHEMBL5124441) |
|---|
| IC50 | 30±n/a nM |
|---|
| Citation |  Li Petri, G; Di Martino, S; De Rosa, M Peptidomimetics: An Overview of Recent Medicinal Chemistry Efforts toward the Discovery of Novel Small Molecule Inhibitors. J Med Chem65:7438-7475 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase, mitochondrial |
|---|
| Name: | Peptide deformylase, mitochondrial |
|---|
| Synonyms: | DEFM_HUMAN | PDF | PDF1A | Peptide deformylase mitochondrial | Peptide deformylase, mitochondrial | Polypeptide deformylase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27023.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_154318 |
|---|
| Residue: | 243 |
|---|
| Sequence: | MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPP
EPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPR
QVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLA
CVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMK
VND
|
|
|
|---|
| BDBM50594242 |
|---|
| n/a |
|---|
| Name | BDBM50594242 |
|---|
| Synonyms: | CHEMBL5191348 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H35N3O5 |
|---|
| Mol. Mass. | 385.4983 |
|---|
| SMILES | CCCCC[C@H](CC(=O)NO)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@@H]1CO |r| |
|---|
| Structure | 
|
|---|
Search and Browse
