Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50292406 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2214254 (CHEMBL5127386) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Tahtouh, T; Durieu, E; Villiers, B; Bruyère, C; Nguyen, TL; Fant, X; Ahn, KH; Khurana, L; Deau, E; Lindberg, MF; Sévère, E; Miege, F; Roche, D; Limanton, E; L'Helgoual'ch, JM; Burgy, G; Guiheneuf, S; Herault, Y; Kendall, DA; Carreaux, F; Bazureau, JP; Meijer, L Structure-Activity Relationship in the Leucettine Family of Kinase Inhibitors. J Med Chem65:1396-1417 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50292406 |
---|
n/a |
---|
Name | BDBM50292406 |
Synonyms: | CHEMBL485053 | leucettamine B |
Type | Small organic molecule |
Emp. Form. | C12H11N3O3 |
Mol. Mass. | 245.234 |
SMILES | CN1C(N)=NC(=Cc2ccc3OCOc3c2)C1=O |w:6.6,c:3| |
Structure |
|