| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 22 |
|---|
| Ligand | BDBM50168889 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305310 (CHEMBL831701) |
|---|
| IC50 | 66000±n/a nM |
|---|
| Citation |  Cutshall, NS; O'Day, C; Prezhdo, M Rhodanine derivatives as inhibitors of JSP-1. Bioorg Med Chem Lett15:3374-9 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 22 |
|---|
| Name: | Dual specificity protein phosphatase 22 |
|---|
| Synonyms: | DUS22_HUMAN | DUSP22 | Dual specificity phosphatase 22 | Dual specificity protein phosphatase (MKPX) | Dual specificity protein phosphatase 22 | Dual specificity protein phosphatase 22 (VHX) | Dual specificity protein phosphatase VHX (VHX) | JSP1 | LMWDSP2 | MKPX | Mitogen-activated protein kinase phosphatase x | VHX |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20915.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9NRW4 |
|---|
| Residue: | 184 |
|---|
| Sequence: | MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA
GRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAF
LRRL
|
|
|
|---|
| BDBM50168889 |
|---|
| n/a |
|---|
| Name | BDBM50168889 |
|---|
| Synonyms: | 3-Methyl-4-{4-oxo-5-[1-phenyl-meth-(Z)-ylidene]-2-thioxo-thiazolidin-3-yl}-benzoic acid | CHEMBL182865 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H13NO3S2 |
|---|
| Mol. Mass. | 355.431 |
|---|
| SMILES | Cc1cc(ccc1N1C(=S)S\C(=C/c2ccccc2)C1=O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
