| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocyte-stimulating hormone receptor |
|---|
| Ligand | BDBM50024372 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305442 (CHEMBL830118) |
|---|
| IC50 | 1100±n/a nM |
|---|
| Citation |  Ujjainwalla, F; Warner, D; Snedden, C; Grisson, RD; Walsh, TF; Wyvratt, MJ; Kalyani, RN; Macneil, T; Tang, R; Weinberg, DH; Van der Ploeg, L; Goulet, MT Design and syntheses of melanocortin subtype-4 receptor agonists. Part 2: discovery of the dihydropyridazinone motif. Bioorg Med Chem Lett15:4023-8 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocyte-stimulating hormone receptor |
|---|
| Name: | Melanocyte-stimulating hormone receptor |
|---|
| Synonyms: | MC1-R | MC1R | MSH-R | MSHR | MSHR_HUMAN | Melanocortin MC1 | Melanocortin receptor (M1 and M4) | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34717.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01726 |
|---|
| Residue: | 317 |
|---|
| Sequence: | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
|
|
|
|---|
| BDBM50024372 |
|---|
| n/a |
|---|
| Name | BDBM50024372 |
|---|
| Synonyms: | CHEMBL2113043 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H36ClFN4O3S |
|---|
| Mol. Mass. | 623.18 |
|---|
| SMILES | COc1ccc(cc1)N1N=C(CC(CC[C@@H](C)NC(=O)[C@H]2CCNC[C@@H]2c2ccc(F)cc2)C1=O)Sc1ccc(Cl)cc1 |c:10| |
|---|
| Structure | 
|
|---|
Search and Browse
