| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Ligand | BDBM50170740 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302233 (CHEMBL827006) |
|---|
| Kd | 48000±n/a nM |
|---|
| Citation |  Smet, C; Duckert, JF; Wieruszeski, JM; Landrieu, I; Buée, L; Lippens, G; Déprez, B Control of protein-protein interactions: structure-based discovery of low molecular weight inhibitors of the interactions between Pin1 WW domain and phosphopeptides. J Med Chem48:4815-23 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18248.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502595 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
|---|
| BDBM50170740 |
|---|
| n/a |
|---|
| Name | BDBM50170740 |
|---|
| Synonyms: | CHEMBL188485 | Phosphoric acid mono-[(1S,3S)-3-(2-carbamoyl-pyrrolidin-1-yl)-1-methyl-3-oxo-2-((R)-5-phenyl-pentanoylamino)-propyl] ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H30N3O7P |
|---|
| Mol. Mass. | 455.4419 |
|---|
| SMILES | C[C@@H](OP(O)(O)=O)[C@H](NC(=O)CCCCc1ccccc1)C(=O)N1CCC[C@H]1C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
