Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor Edg-4
LigandBDBM50170846
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303184
Ki 3550±n/a nM
Citation Durgam GGVirag TWalker MDTsukahara RYasuda SLiliom Kvan Meeteren LAMoolenaar WHWilke NSiess WTigyi GMiller DD Synthesis, structure-activity relationships, and biological evaluation of fatty alcohol phosphates as lysophosphatidic acid receptor ligands, activators of PPARgamma, and inhibitors of autotaxin. J Med Chem 48:4919-30 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor Edg-4
Name:Lysophosphatidic acid receptor Edg-4
Synonyms:LPA receptor 2 | LPA-2 | Lysophosphatidic acid receptor 2
Type:PROTEIN
Mol. Mass.:39103.44
Organism:Homo sapiens (Human)
Description:ChEMBL_1451385
Residue:351
Sequence:
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170846
n/a
NameBDBM50170846
Synonyms:CHEMBL190999 | Tetradecyl-phosphonic acid
TypeSmall organic molecule
Emp. Form.C14H31O3P
Mol. Mass.278.3679
SMILESCCCCCCCCCCCCCCP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: