| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50064946 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2220293 (CHEMBL5133627) |
|---|
| Ki | 2.4±n/a nM |
|---|
| Citation |  Dichiara, M; Artacho-Cordón, A; Turnaturi, R; Santos-Caballero, M; González-Cano, R; Pasquinucci, L; Barbaraci, C; Rodríguez-Gómez, I; Gómez-Guzmán, M; Marrazzo, A; Cobos, EJ; Amata, E Dual Sigma-1 receptor antagonists and hydrogen sulfide-releasing compounds for pain treatment: Design, synthesis, and pharmacological evaluation. Eur J Med Chem230:0 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50064946 |
|---|
| n/a |
|---|
| Name | BDBM50064946 |
|---|
| Synonyms: | 4-(4-Chloro-phenyl)-1-[4-(4-fluoro-phenyl)-4-hydroxy-butyl]-piperidin-4-ol | CHEMBL1036 | Hydroxyhaloperidol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25ClFNO2 |
|---|
| Mol. Mass. | 377.88 |
|---|
| SMILES | OC(CCCN1CCC(O)(CC1)c1ccc(Cl)cc1)c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
