| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50172015 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_312623 (CHEMBL834112) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Balboni, G; Cocco, MT; Salvadori, S; Romagnoli, R; Sasaki, Y; Okada, Y; Bryant, SD; Jinsmaa, Y; Lazarus, LH From the potent and selective mu opioid receptor agonist H-Dmt-d-Arg-Phe-Lys-NH(2) to the potent delta antagonist H-Dmt-Tic-Phe-Lys(Z)-OH. J Med Chem48:5608-11 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50172015 |
|---|
| n/a |
|---|
| Name | BDBM50172015 |
|---|
| Synonyms: | (S)-2-[(S)-2-({2-[2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carbonyl}-amino)-3-phenyl-propionylamino]-6-benzyloxycarbonylamino-hexanoic acid | CHEMBL3143757 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H51N5O8 |
|---|
| Mol. Mass. | 777.9044 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2C[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCNC(=O)OCc1ccccc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
