Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50172874 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_321541 (CHEMBL881479) |
---|
pH | 7.5±n/a |
---|
IC50 | 2.9±n/a nM |
---|
Comments | extracted |
---|
Citation | Cazenave Gassiot, A; Charton, J; Girault-Mizzi, S; Gilleron, P; Debreu-Fontaine, MA; Sergheraert, C; Melnyk, P Synthesis and pharmacological evaluation of Tic-hydantoin derivatives as selective sigma1 ligands. Part 2. Bioorg Med Chem Lett15:4828-32 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50172874 |
---|
n/a |
---|
Name | BDBM50172874 |
Synonyms: | (S)-2-{2-[Methyl-(5-phenyl-pentyl)-amino]-ethyl}-10,10a-dihydro-5H-imidazo[1,5-b]isoquinoline-1,3-dione | CHEMBL194738 |
Type | Small organic molecule |
Emp. Form. | C25H31N3O2 |
Mol. Mass. | 405.5325 |
SMILES | CN(CCCCCc1ccccc1)CCn1c(O)c2Cc3ccccc3Cn2c1=O |
Structure |
|