| Reaction Details |
|---|
 | Report a problem with these data |
| Target | GTPase KRas |
|---|
| Ligand | BDBM50597305 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2223229 (CHEMBL5136563) |
|---|
| IC50 | 1.000000±n/a nM |
|---|
| Citation |  Garrigou, M; Sauvagnat, B; Duggal, R; Boo, N; Gopal, P; Johnston, JM; Partridge, A; Sawyer, T; Biswas, K; Boyer, N Accelerated Identification of Cell Active KRAS Inhibitory Macrocyclic Peptides using Mixture Libraries and Automated Ligand Identification System (ALIS) Technology. J Med Chem65:8961-8974 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| GTPase KRas |
|---|
| Name: | GTPase KRas |
|---|
| Synonyms: | GTPase KRas, N-terminally processed | K-Ras 2 | KRAS | KRAS2 | Ki-Ras | RASK2 | RASK_HUMAN | c-K-ras | c-Ki-ras |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21656.10 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1476955 |
|---|
| Residue: | 189 |
|---|
| Sequence: | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
|
|
|
|---|
| BDBM50597305 |
|---|
| n/a |
|---|
| Name | BDBM50597305 |
|---|
| Synonyms: | CHEMBL5205422 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C87H131N27O20S2 |
|---|
| Mol. Mass. | 1939.27 |
|---|
| SMILES | CC[C@H](C)[C@@H]1NC(=O)[C@H](Cc2ccc(cc2)-c2ccccc2)NC(=O)[C@@H]2[C@H](CCN2C(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@@H]2CCCN2C(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@H](CO)NC1=O)C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(C)=O)OCC=C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
