Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM50175843
Substrate/Competitorn/a
Meas. Tech.ChEMBL_327753
Ki 0.2±n/a nM
Citation Vaccaro WDSher RBerlin MShih NYAslanian RSchwerdt JHMcCormick KDPiwinski JJWest REAnthes JCWilliams SMWu RLShe HSRivelli MAMutter JCCorboz MRHey JAFavreau L Novel histamine H3 receptor antagonists based on the 4-[(1H-imidazol-4-yl)methyl]piperidine scaffold. Bioorg Med Chem Lett 16:395-9 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HRH3
Name:Histamine H3 receptor
Synonyms:HISTAMINE H3 | Histamine H3 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48753.61
Organism:GUINEA PIG
Description:HISTAMINE H3 HRH3 GUINEA PIG::Q9JI35
Residue:445
Sequence:
MERAPPDGLMNASGALAGEAAAAAGGARTFSAAWTAVLAALMALLIVATVLGNALVMLAF
VADSSLRTQNNFFLLNLAISDFLVGVFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCT
SSVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMVLVWVLAFLLYGPAILSWEYLSG
GSSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGARE
AGPDPLPEAQSSPPQPPPGCWGCWPKGQGESMPLHRYGVGEAGPGAEAGEAALGGGSGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50175843
n/a
NameBDBM50175843
Synonyms:3-(4-((1H-imidazol-4-yl)methyl)piperidin-1-yl)-N-(3-chlorophenyl)propanamide | CHEMBL373000
TypeSmall organic molecule
Emp. Form.C18H23ClN4O
Mol. Mass.346.854
SMILESClc1cccc(NC(=O)CCN2CCC(Cc3cnc[nH]3)CC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: