Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-2 |
---|
Ligand | BDBM50599555 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2230870 (CHEMBL5144642) |
---|
Ki | 10000±n/a nM |
---|
Citation | Ettari, R; Iraci, N; Di Chio, C; Previti, S; Danzč, M; Zappalą, M Development of isoquinolinone derivatives as immunoproteasome inhibitors. Bioorg Med Chem Lett55:0 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-2 |
---|
Name: | Proteasome subunit beta type-2 |
Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
Type: | PROTEIN |
Mol. Mass.: | 22837.53 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1294233 |
Residue: | 201 |
Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
BDBM50599555 |
---|
n/a |
---|
Name | BDBM50599555 |
Synonyms: | CHEMBL5192242 |
Type | Small organic molecule |
Emp. Form. | C19H24N2O4 |
Mol. Mass. | 344.4049 |
SMILES | CCCCNC(=O)\C=C\Cn1ccc2cc(OC)c(OC)cc2c1=O |
Structure |
|