| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-2 |
|---|
| Ligand | BDBM50599556 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2230870 (CHEMBL5144642) |
|---|
| Ki | 4000±n/a nM |
|---|
| Citation |  Ettari, R; Iraci, N; Di Chio, C; Previti, S; Danzč, M; Zappalą, M Development of isoquinolinone derivatives as immunoproteasome inhibitors. Bioorg Med Chem Lett55:0 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-2 |
|---|
| Name: | Proteasome subunit beta type-2 |
|---|
| Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22837.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1294233 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
|---|
| BDBM50599556 |
|---|
| n/a |
|---|
| Name | BDBM50599556 |
|---|
| Synonyms: | CHEMBL5182479 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H26N2O4 |
|---|
| Mol. Mass. | 358.4314 |
|---|
| SMILES | COc1cc2ccn(C\C=C\C(=O)NCCC(C)C)c(=O)c2cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
