Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-8 receptors, CXCR2
LigandBDBM50177615
Substrate/Competitorn/a
Meas. Tech.ChEMBL_334048
IC50 9.5±n/a nM
Citation Baxter ACooper AKinchin EMoakes KUnitt JWallace A Hit-to-Lead studies: the discovery of potent, orally bioavailable thiazolopyrimidine CXCR2 receptor antagonists. Bioorg Med Chem Lett 16:960-3 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-8 receptors, CXCR2
Name:Interleukin-8 receptors, CXCR1/CXCR2
Synonyms:C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | Interleukin-8 receptor B
Type:Protein
Mol. Mass.:40767.88
Organism:Homo sapiens (Human)
Description:P25025
Residue:360
Sequence:
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177615
n/a
NameBDBM50177615
Synonyms:(R)-2-(5-(2,3-difluorobenzylthio)-2-aminothiazolo[4,5-d]pyrimidin-7-ylamino)butan-1-ol | CHEMBL380732
TypeSmall organic molecule
Emp. Form.C16H17F2N5OS2
Mol. Mass.397.466
SMILESCC[C@H](CO)Nc1nc(SCc2cccc(F)c2F)nc2nc(N)sc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: