Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A3 |
---|
Ligand | BDBM21173 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_325473 (CHEMBL860157) |
---|
Ki | 1300±n/a nM |
---|
Citation | Catarzi, D; Colotta, V; Varano, F; Lenzi, O; Filacchioni, G; Trincavelli, L; Martini, C; Montopoli, C; Moro, S 1,2,4-Triazolo[1,5-a]quinoxaline as a versatile tool for the design of selective human A3 adenosine receptor antagonists: synthesis, biological evaluation, and molecular modeling studies of 2-(hetero)aryl- and 2-carboxy-substituted derivatives. J Med Chem48:7932-45 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A3 |
---|
Name: | Adenosine receptor A3 |
Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36197.32 |
Organism: | Homo sapiens (Human) |
Description: | P0DMS8 |
Residue: | 318 |
Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
BDBM21173 |
---|
n/a |
---|
Name | BDBM21173 |
Synonyms: | 1,3-dipropyl-8-cyclopentylxanthine | 8-cyclopentyl-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | CHEMBL183 | DPCPX | PD116948 | [3H]DPCPX |
Type | radiolabeled ligand |
Emp. Form. | C16H24N4O2 |
Mol. Mass. | 304.3874 |
SMILES | CCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)C1CCCC1 |
Structure |
|