| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fibroblast growth factor 1 |
|---|
| Ligand | BDBM50179253 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_325518 (CHEMBL860173) |
|---|
| Kd | 0.144±n/a nM |
|---|
| Citation |  Karoli, T; Liu, L; Fairweather, JK; Hammond, E; Li, CP; Cochran, S; Bergefall, K; Trybala, E; Addison, RS; Ferro, V Synthesis, biological activity, and preliminary pharmacokinetic evaluation of analogues of a phosphosulfomannan angiogenesis inhibitor (PI-88). J Med Chem48:8229-36 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fibroblast growth factor 1 |
|---|
| Name: | Fibroblast growth factor 1 |
|---|
| Synonyms: | Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | FGF1 | FGF1_HUMAN | FGFA | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17461.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05230 |
|---|
| Residue: | 155 |
|---|
| Sequence: | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
|
|
|
|---|
| BDBM50179253 |
|---|
| n/a |
|---|
| Name | BDBM50179253 |
|---|
| Synonyms: | (2R,3S,4S,5S,6R)-2-{[(2R,3S,4S,5R,6R)-2-{[(2R,3S,4S,5R,6R)-2-{[(2R,3S,4S,5R,6R)-2-{[(2S,3S,4S,5S,6R)-4,5-dihydroxy-6-(hydroxymethyl)-2-(octyloxy)oxan-3-yl]oxy}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy}-6-(hydroxymethyl)oxane-3,4,5-triol | CHEMBL198643 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H68O26 |
|---|
| Mol. Mass. | 940.9309 |
|---|
| SMILES | CCCCCCCCO[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]1O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O[C@H]2O[C@H](CO)[C@@H](O)[C@H](O[C@H]3O[C@H](CO)[C@@H](O)[C@H](O[C@H]4O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]4O)[C@@H]3O)[C@@H]2O)[C@@H]1O |
|---|
| Structure | 
|
|---|
Search and Browse
