Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50180054
Substrate/Competitorn/a
Meas. Tech.ChEMBL_329919
Ki 480±n/a nM
Citation Kumar JSMajo VJHsiung SCMillak MSLiu KPTamir HPrabhakaran JSimpson NRVan Heertum RLMann JJParsey RV Synthesis and in vivo validation of [O-methyl-11C]2-{4-[4-(7-methoxynaphthalen-1-yl)piperazin- 1-yl]butyl}-4-methyl-2H-[1,2,4]triazine-3,5-dione: a novel 5-HT1A receptor agonist positron emission tomography ligand. J Med Chem 49:125-34 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50180054
n/a
NameBDBM50180054
Synonyms:CHEMBL199824 | [O-methyl-11C]2-{4-[4-(7-methoxynaphthalen-1-yl)piperazin-1-yl]butyl}-4-methyl-2H-[1,2,4]triazine-3,5-dione
TypeSmall organic molecule
Emp. Form.C23H29N5O3
Mol. Mass.423.5081
SMILESCOc1ccc2cccc(N3CCN(CCCCn4ncc(=O)n(C)c4=O)CC3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: