| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-1 receptor antagonist protein |
|---|
| Ligand | BDBM50601036 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2235735 (CHEMBL5149507) |
|---|
| IC50 | 820±n/a nM |
|---|
| Citation |  Vourloumis, D; Mavridis, I; Athanasoulis, A; Temponeras, I; Koumantou, D; Giastas, P; Mpakali, A; Magrioti, V; Leib, J; van Endert, P; Stratikos, E; Papakyriakou, A Discovery of Selective Nanomolar Inhibitors for Insulin-Regulated Aminopeptidase Based on ?-Hydroxy-?-amino Acid Derivatives of Bestatin. J Med Chem65:10098-10117 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-1 receptor antagonist protein |
|---|
| Name: | Interleukin-1 receptor antagonist protein |
|---|
| Synonyms: | ICIL-1RA | IL-1RN | IL-1ra | IL1 inhibitor | IL1F3 | IL1RA | IL1RA_HUMAN | IL1RN | INN=Anakinra | IRAP | Interleukin-1 receptor antagonist protein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 20053.78 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_118941 |
|---|
| Residue: | 177 |
|---|
| Sequence: | MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYL
QGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD
KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
|
|
|
|---|
| BDBM50601036 |
|---|
| n/a |
|---|
| Name | BDBM50601036 |
|---|
| Synonyms: | CHEMBL5184077 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H37N3O8 |
|---|
| Mol. Mass. | 531.598 |
|---|
| SMILES | COC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](O)[C@H](N)CCOc1cccc(O)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
