Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 1 |
---|
Ligand | BDBM50181882 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_332730 (CHEMBL859054) |
---|
Ki | 1000±n/a nM |
---|
Citation | Wendt, MD; Shen, W; Kunzer, A; McClellan, WJ; Bruncko, M; Oost, TK; Ding, H; Joseph, MK; Zhang, H; Nimmer, PM; Ng, SC; Shoemaker, AR; Petros, AM; Oleksijew, A; Marsh, K; Bauch, J; Oltersdorf, T; Belli, BA; Martineau, D; Fesik, SW; Rosenberg, SH; Elmore, SW Discovery and structure-activity relationship of antagonists of B-cell lymphoma 2 family proteins with chemopotentiation activity in vitro and in vivo. J Med Chem49:1165-81 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 1 |
---|
Name: | Bcl-2-like protein 1 |
Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
Type: | Mitochondrion membrane; Single-pass membrane protein |
Mol. Mass.: | 26039.60 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 233 |
Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
BDBM50181882 |
---|
n/a |
---|
Name | BDBM50181882 |
Synonyms: | (R)-3-(4-{[2'-methoxy-4'-(3-morpholin-4-ylpropyl)biphenyl-4-carbonyl]sulfamoyl}-2-nitrophenylamino)-N,N-dimethyl-4-phenylsulfanylbutyramide | CHEMBL383399 |
Type | Small organic molecule |
Emp. Form. | C39H45N5O8S2 |
Mol. Mass. | 775.933 |
SMILES | COc1cc(CCCN2CCOCC2)ccc1-c1ccc(cc1)C(=O)NS(=O)(=O)c1ccc(N[C@@H](CSc2ccccc2)CC(=O)N(C)C)c(c1)[N+]([O-])=O |
Structure |
|