Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-like protein 1
LigandBDBM50181869
Substrate/Competitorn/a
Meas. Tech.ChEMBL_332732
EC50 1200±n/a nM
Citation Wendt MDShen WKunzer AMcClellan WJBruncko MOost TKDing HJoseph MKZhang HNimmer PMNg SCShoemaker ARPetros AMOleksijew AMarsh KBauch JOltersdorf TBelli BAMartineau DFesik SWRosenberg SHElmore SW Discovery and structure-activity relationship of antagonists of B-cell lymphoma 2 family proteins with chemopotentiation activity in vitro and in vivo. J Med Chem 49:1165-81 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bcl-2-like protein 1
Name:Bcl-2-like protein 1
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens (Human)
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181869
n/a
NameBDBM50181869
Synonyms:4-((R)-5-dimethylamino-1-phenylsulfanylmethylpentylamino)-N-[2'-methoxy-4'-(3-morpholin-4-ylpropyl)biphenyl-4-carbonyl]-3-nitrobenzenesulfonamide | CHEMBL201947
TypeSmall organic molecule
Emp. Form.C41H51N5O7S2
Mol. Mass.790.003
SMILESCOc1cc(CCCN2CCOCC2)ccc1-c1ccc(cc1)C(=O)NS(=O)(=O)c1ccc(N[C@H](CCCCN(C)C)CSc2ccccc2)c(c1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: