Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM50181877 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_332728 (CHEMBL859052) |
---|
Ki | 73±n/a nM |
---|
Citation | Wendt, MD; Shen, W; Kunzer, A; McClellan, WJ; Bruncko, M; Oost, TK; Ding, H; Joseph, MK; Zhang, H; Nimmer, PM; Ng, SC; Shoemaker, AR; Petros, AM; Oleksijew, A; Marsh, K; Bauch, J; Oltersdorf, T; Belli, BA; Martineau, D; Fesik, SW; Rosenberg, SH; Elmore, SW Discovery and structure-activity relationship of antagonists of B-cell lymphoma 2 family proteins with chemopotentiation activity in vitro and in vivo. J Med Chem49:1165-81 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM50181877 |
---|
n/a |
---|
Name | BDBM50181877 |
Synonyms: | 4-((R)-5-dimethylamino-1-phenylsulfanylmethylpentylamino)-N-[4-(4,4-dimethylpiperidin-1-yl)benzoyl]-3-nitrobenzenesulfonamide | CHEMBL370835 |
Type | Small organic molecule |
Emp. Form. | C34H45N5O5S2 |
Mol. Mass. | 667.882 |
SMILES | CN(C)CCCC[C@H](CSc1ccccc1)Nc1ccc(cc1[N+]([O-])=O)S(=O)(=O)NC(=O)c1ccc(cc1)N1CCC(C)(C)CC1 |
Structure |
|