Reaction Details |
| Report a problem with these data |
Target | HLA class II histocompatibility antigen gamma chain |
---|
Ligand | BDBM50182115 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_347360 (CHEMBL865649) |
---|
IC50 | 930±n/a nM |
---|
Citation | Grice, CA; Tays, K; Khatuya, H; Gustin, DJ; Butler, CR; Wei, J; Sehon, CA; Sun, S; Gu, Y; Jiang, W; Thurmond, RL; Karlsson, L; Edwards, JP The SAR of 4-substituted (6,6-bicyclic) piperidine cathepsin S inhibitors. Bioorg Med Chem Lett16:2209-12 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
HLA class II histocompatibility antigen gamma chain |
---|
Name: | HLA class II histocompatibility antigen gamma chain |
Synonyms: | CD74 | DHLAG | HG2A_HUMAN | HLA-DR antigens-associated invariant chain |
Type: | PROTEIN |
Mol. Mass.: | 33525.85 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_347360 |
Residue: | 296 |
Sequence: | MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP
LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
|
|
|
BDBM50182115 |
---|
n/a |
---|
Name | BDBM50182115 |
Synonyms: | 1-(1-(2-hydroxy-3-(5-(methylsulfonyl)-3-(4-(trifluoromethyl)phenyl)-4,5,6,7-tetrahydropyrazolo[4,3-c]pyridin-1-yl)propyl)piperidin-4-yl)benzo[e][1,4]oxazepin-2(1H,3H,5H)-one | CHEMBL207003 |
Type | Small organic molecule |
Emp. Form. | C31H36F3N5O5S |
Mol. Mass. | 647.708 |
SMILES | CS(=O)(=O)N1CCc2c(C1)c(nn2CC(O)CN1CCC(CC1)N1c2ccccc2COCC1=O)-c1ccc(cc1)C(F)(F)F |
Structure |
|