Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50184828 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_342610 (CHEMBL861259) |
---|
IC50 | 8000±n/a nM |
---|
Citation | Wildemann, D; Erdmann, F; Alvarez, BH; Stoller, G; Zhou, XZ; Fanghänel, J; Schutkowski, M; Lu, KP; Fischer, G Nanomolar inhibitors of the peptidyl prolyl cis/trans isomerase Pin1 from combinatorial peptide libraries. J Med Chem49:2147-50 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50184828 |
---|
n/a |
---|
Name | BDBM50184828 |
Synonyms: | Ac-Lys(N-epsilon-biotinoyl)-Ala-Ala-tBuPhe-Thr(PO3H2)-Tic-Bth-Gln-NH2 | CHEMBL414584 |
Type | Small organic molecule |
Emp. Form. | C67H92N13O16PS2 |
Mol. Mass. | 1430.629 |
SMILES | C[C@H](OP(O)(O)=O)[C@H](NC(=O)[C@H](Cc1ccc(cc1)C(C)(C)C)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12)NC(C)=O)C(=O)N1Cc2ccccc2C[C@H]1C(=O)N[C@@H](Cc1csc2ccccc12)C(=O)N[C@@H](CCC(N)=O)C(N)=O |
Structure |
|