Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine phosphoribosyltransferase |
---|
Ligand | BDBM50603687 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2244965 (CHEMBL5159175) |
---|
Ki | 200±n/a nM |
---|
Citation | Klejch, T; Keough, DT; King, G; Dole?elová, E; ?esnek, M; Bud??ínský, M; Zíková, A; Janeba, Z; Guddat, LW; Hocková, D Stereo-Defined Acyclic Nucleoside Phosphonates are Selective and Potent Inhibitors of Parasite 6-Oxopurine Phosphoribosyltransferases. J Med Chem65:4030-4057 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hypoxanthine-guanine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine phosphoribosyltransferase |
Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
Type: | Protein |
Mol. Mass.: | 24579.61 |
Organism: | Homo sapiens (Human) |
Description: | P00492 |
Residue: | 218 |
Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
BDBM50603687 |
---|
n/a |
---|
Name | BDBM50603687 |
Synonyms: | CHEMBL5186759 |
Type | Small organic molecule |
Emp. Form. | C9H12N5Na2O6P |
Mol. Mass. | 363.1748 |
SMILES | n/a |
Structure |
|