| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-8 |
|---|
| Ligand | BDBM50604324 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2247504 (CHEMBL5161714) |
|---|
| IC50 | 2.9±n/a nM |
|---|
| Citation |  Nan, G; Huang, L; Li, Y; Yang, Y; Yang, Y; Li, K; Lai, F; Chen, X; Xiao, Z Identification of N, C-capped di- and tripeptides as selective immunoproteasome inhibitors. Eur J Med Chem234:0 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-8 |
|---|
| Name: | Proteasome subunit beta type-8 |
|---|
| Synonyms: | 26S proteosome | LMP7 | Low molecular mass protein 7 | Macropain subunit C13 | Multicatalytic endopeptidase complex subunit C13 | PSB8_HUMAN | PSMB5i | PSMB8 | Proteasome component C13 | Proteasome subunit beta type-8 | Proteasome subunit beta-5i | RING10 | Y2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30357.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1446797 |
|---|
| Residue: | 276 |
|---|
| Sequence: | MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
|
|
|
|---|
| BDBM50604324 |
|---|
| n/a |
|---|
| Name | BDBM50604324 |
|---|
| Synonyms: | CHEMBL5183361 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H44N6O6 |
|---|
| Mol. Mass. | 668.7819 |
|---|
| SMILES | Cc1ccc(CNC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CCC(=O)NC(C)(C)C)NC(=O)CCNC(=O)C(=C\c2ccco2)\C#N)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
