| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 6 |
|---|
| Ligand | BDBM50110183 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2260099 (CHEMBL5215110) |
|---|
| IC50 | 10.0±n/a nM |
|---|
| Citation |  Bass, AKA; El-Zoghbi, MS; Nageeb, EM; Mohamed, MFA; Badr, M; Abuo-Rahma, GEA Comprehensive review for anticancer hybridized multitargeting HDAC inhibitors. Eur J Med Chem209:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 6 |
|---|
| Name: | Cyclin-dependent kinase 6 |
|---|
| Synonyms: | CDK6 | CDK6_HUMAN | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 36937.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q00534 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
|
|
|
|---|
| BDBM50110183 |
|---|
| n/a |
|---|
| Name | BDBM50110183 |
|---|
| Synonyms: | Abemaciclib | LY-2835219 | US10626107, Example LY2835219 | US10662186, Compound LY2835219 | US10696678, Example LY2835219 | US10988476, Compound LY2835219 | US11053238, LY2835219 | US11091476, Example LY2835219 | US11351170, Example Abemaciclib |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H32F2N8 |
|---|
| Mol. Mass. | 506.5934 |
|---|
| SMILES | CCN1CCN(Cc2ccc(Nc3ncc(F)c(n3)-c3cc(F)c4nc(C)n(C(C)C)c4c3)nc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
