| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50190436 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_375257 (CHEMBL867484) |
|---|
| Ki | 180±n/a nM |
|---|
| Citation |  Tafi, A; Bernardini, C; Botta, M; Corelli, F; Andreini, M; Martinelli, A; Ortore, G; Baraldi, PG; Fruttarolo, F; Borea, PA; Tuccinardi, T Pharmacophore based receptor modeling: the case of adenosine A3 receptor antagonists. An approach to the optimization of protein models. J Med Chem49:4085-97 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50190436 |
|---|
| n/a |
|---|
| Name | BDBM50190436 |
|---|
| Synonyms: | 4-Ethyl-2-methyl-6-phenyl-pyridine-3,5-dicarboxylic acid diethyl ester | CHEMBL111260 | diethyl 4-ethyl-2-methyl-6-phenylpyridine-3,5-dicarboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23NO4 |
|---|
| Mol. Mass. | 341.4009 |
|---|
| SMILES | CCOC(=O)c1c(C)nc(-c2ccccc2)c(C(=O)OCC)c1CC |
|---|
| Structure | 
|
|---|
Search and Browse
