Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain-1
LigandBDBM50193504
Substrate/Competitorn/a
Meas. Tech.ChEMBL_386232
Ki 128±n/a nM
Citation Korukonda RGuan NDalton JTLiu JDonkor IO Synthesis, calpain inhibitory activity, and cytotoxicity of P2-substituted proline and thiaproline peptidyl aldehydes and peptidyl alpha-ketoamides. J Med Chem 49:5282-90 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calpain-1
Name:Calpain 1
Synonyms:CANP 1 | Calcium-activated neutral proteinase 1 | Calpain mu-type | Calpain-1 catalytic subunit | Calpain-1 large subunit | Micromolar-calpain | muCANP
Type:Catalytic subunit; forms a heterodimer with a small (regulatory) subunit (CAPNS1)
Mol. Mass.:81729.82
Organism:Sus scrofa (pig)
Description:Native calpain-1 from porcine erythrocytes, purchased from Calbiochem, was used in assay.
Residue:714
Sequence:
MAEEVITPVYCTGVSAQVQKLRAKELGLGRHENAIKYLGQDYEQLRAHCLQSGSLFRDEA
FPPVPQSLGFKELGPNSSKTYGVKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYSIILK
ALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVNLIRMRNPWGE
VEWTGAWSDGSSEWNGVDPYQRDQLRVRMEDGEFWMSFRDFLREFTRLEICNLTPDALKS
QRVRNWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDPEDDYGGRESGCSF
VLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKKAGTQELDDQVQAILPDEQVLSE
EEIDENFKALFRQLAGEDMEISVRELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLFELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193504
n/a
NameBDBM50193504
Synonyms:(R)-1-(4-bromophenylsulfonyl)-N-((R,S)-1-oxo-3-phenylpropan-2-yl)pyrrolidine-2-carboxamide | CHEMBL213107
TypeSmall organic molecule
Emp. Form.C20H21BrN2O4S
Mol. Mass.465.361
SMILESBrc1ccc(cc1)S(=O)(=O)N1CCC[C@@H]1C(=O)NC(Cc1ccccc1)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: