Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 3
LigandBDBM50198394
Substrate/Competitorn/a
Meas. Tech.ChEMBL_437678
Ki 400±n/a nM
Citation Allen DRBolt AChapman GAKnight RLMeissner JWOwen DAWatson RJ Identification and structure-activity relationships of 1-aryl-3-piperidin-4-yl-urea derivatives as CXCR3 receptor antagonists. Bioorg Med Chem Lett 17:697-701 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 3
Name:C-X-C chemokine receptor type 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41020.84
Organism:Mus musculus
Description:ChEMBL_560734
Residue:367
Sequence:
MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPALYS
LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAVQWVFGP
GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPRVRVALTCIVVWGLCLL
FALPDFIYLSANYDQRLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAV
LLVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS
VTSGMGYMHCCLNPLLYAFVGVKFREQMWMLFTRLGRSDQRGPQRQPSSSRRESSWSETT
EASYLGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50198394
n/a
NameBDBM50198394
Synonyms:(E)-1-(1-(cyclooctenylmethyl)piperidin-4-yl)-3-(naphthalen-2-yl)urea | 1-(1-(cyclooctenylmethyl)piperidin-4-yl)-3-(naphthalen-2-yl)urea | CHEMBL244610
TypeSmall organic molecule
Emp. Form.C25H33N3O
Mol. Mass.391.549
SMILESO=C(NC1CCN(C\C2=C\CCCCCC2)CC1)Nc1ccc2ccccc2c1 |t:8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: