| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50612783 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2289803 |
|---|
| Ki | 23±n/a nM |
|---|
| Citation |  Tolentino, KT; Mashinson, V; Sharma, MK; Chhonker, YS; Murry, DJ; Hopkins, CR From dopamine 4 to sigma 1: Synthesis, SAR and biological characterization of a piperidine scaffold of ?1 modulators. Eur J Med Chem244:0 (2022) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20857.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q5BJF2 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
|---|
| BDBM50612783 |
|---|
| n/a |
|---|
| Name | BDBM50612783 |
|---|
| Synonyms: | CHEMBL5274285 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H24ClF2N3 |
|---|
| Mol. Mass. | 415.907 |
|---|
| SMILES | Fc1ccc(CN2CCCC22CCN(Cc3cc4ccc(Cl)cc4[nH]3)C2)cc1F |
|---|
| Structure | 
|
|---|
Search and Browse
