| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-synuclein |
|---|
| Ligand | BDBM50614044 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2295411 |
|---|
| Kd | 40±n/a nM |
|---|
| Citation |  Haque, R; Maity, D Small molecule-based fluorescent probes for the detection of ?-Synuclein aggregation states. Bioorg Med Chem Lett86:0 (2023) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alpha-synuclein |
|---|
| Name: | Alpha-synuclein |
|---|
| Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14451.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P37840 |
|---|
| Residue: | 140 |
|---|
| Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
|---|
| BDBM50614044 |
|---|
| n/a |
|---|
| Name | BDBM50614044 |
|---|
| Synonyms: | CHEMBL5283353 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H14N4S |
|---|
| Mol. Mass. | 306.385 |
|---|
| SMILES | [#6]-[#7](-[#6])-c1ccc2nc(\[#6]=[#6]\[#6]=[#6]\[#6]=[#6](\C#N)C#N)sc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
