| Reaction Details |
|---|
 | Report a problem with these data |
| Target | PA-I galactophilic lectin |
|---|
| Ligand | BDBM50614329 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2296501 |
|---|
| Kd | 100±n/a nM |
|---|
| Citation |  Wagner, S; Sommer, R; Hinsberger, S; Lu, C; Hartmann, RW; Empting, M; Titz, A Novel Strategies for the Treatment of Pseudomonas aeruginosa Infections. J Med Chem59:5929-69 (2016) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| PA-I galactophilic lectin |
|---|
| Name: | PA-I galactophilic lectin |
|---|
| Synonyms: | Galactose-binding lectin | PA-I galactophilic lectin | PA-IL | PA1L_PSEAE | lecA | pa1L |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 12891.24 |
|---|
| Organism: | Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG12228) |
|---|
| Description: | ChEMBL_109520 |
|---|
| Residue: | 122 |
|---|
| Sequence: | MAWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHD
AFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKD
QS
|
|
|
|---|
| BDBM50614329 |
|---|
| n/a |
|---|
| Name | BDBM50614329 |
|---|
| Synonyms: | CHEMBL3797852 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H27NO8S |
|---|
| Mol. Mass. | 405.463 |
|---|
| SMILES | [H][C@@]1(O[C@H](OC)[C@@H](O)[C@@H](O)[C@@H]1O)[C@@H](O)CNS(=O)(=O)c1c(C)cc(C)cc1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
