Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Sgk1
LigandBDBM50204693
Substrate/Competitorn/a
Meas. Tech.ChEMBL_442111
IC50 15000±n/a nM
Citation Tong YClaiborne AStewart KDPark CKovar PChen ZCredo RBGu WZGwaltney SLJudge RAZhang HRosenberg SHSham HLSowin TJLin NH Discovery of 1,4-dihydroindeno[1,2-c]pyrazoles as a novel class of potent and selective checkpoint kinase 1 inhibitors. Bioorg Med Chem 15:2759-67 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Sgk1
Name:Serine/threonine-protein kinase Sgk1
Synonyms:SGK1 | Serine/threonine-protein kinase Sgk1 | Serine/threonine-protein kinase Sgk1 (SGK) | Serum/glucocorticoid regulated kinase | Serum/glucocorticoid-regulated kinase 1 (SGK1)
Type:Other Protein Type
Mol. Mass.:48954.40
Organism:Homo sapiens (Human)
Description:Recombinant human SGK-1 enzyme produced in a baculovirus system.
Residue:431
Sequence:
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204693
n/a
NameBDBM50204693
Synonyms:3-(4'-hydroxy-biphenyl-4-yl)-1,4-dihydro-indeno[1,2-c]pyrazole-6-carboxylic acid (pyridin-4-ylmethyl)-amide | CHEMBL242753
TypeSmall organic molecule
Emp. Form.C29H22N4O2
Mol. Mass.458.5106
SMILESOc1ccc(cc1)-c1ccc(cc1)-c1n[nH]c-2c1Cc1cc(ccc-21)C(=O)NCc1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: