Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLutropin-choriogonadotropic hormone receptor
LigandBDBM50206401
Substrate/Competitorn/a
Meas. Tech.ChEMBL_454742
Ki 311±n/a nM
Citation Jorand-Lebrun CBrondyk BLin JMagar SMurray RReddy AShroff HWands GWeiser WXu QMcKenna SBrugger N Identification, synthesis, and biological evaluation of novel pyrazoles as low molecular weight luteinizing hormone receptor agonists. Bioorg Med Chem Lett 17:2080-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lutropin-choriogonadotropic hormone receptor
Name:Lutropin-choriogonadotropic hormone receptor
Synonyms:LCGR | LGR2 | LH/CG-R | LHCGR | LHR | LHRHR | LSH-R | Luteinizing hormone receptor
Type:PROTEIN
Mol. Mass.:78662.77
Organism:Homo sapiens (Human)
Description:ChEMBL_562598
Residue:699
Sequence:
MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLP
VKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFI
NLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLK
LYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSY
GLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
SKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMGYD
FLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRL
RHAILIMLGGWLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFF
IICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLIT
VTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSAYT
SNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50206401
n/a
NameBDBM50206401
Synonyms:CHEMBL246321 | N-((S)-1-amino-3-(4-hydroxyphenyl)-1-oxopropan-2-yl)-5-(1-(4-tert-butylphenyl)-3-(pyridin-3-yl)-1H-pyrazol-5-yl)pentanamide
TypeSmall organic molecule
Emp. Form.C32H37N5O3
Mol. Mass.539.6679
SMILESCC(C)(C)c1ccc(cc1)-n1nc(cc1CCCCC(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O)-c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: